DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ef and Cpr65Ax2

DIOPT Version :9

Sequence 1:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001261467.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster


Alignment Length:86 Identity:36/86 - (41%)
Similarity:49/86 - (56%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SGPPIPILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPEGELVE 194
            :.|.:.:|. .:.|.|..||.::.||.:|....|||.:||.|:|.|..|..||:||..|:|:...
  Fly    16 AAPTVEVLR-SDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYT 79

  Fly   195 IMYTADENGFVPSGNALPTPP 215
            :.|.||||||.|.|..||..|
  Fly    80 VTYVADENGFQPQGAHLPVAP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:278791 24/54 (44%)
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.