DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ef and CG8927

DIOPT Version :9

Sequence 1:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:183 Identity:39/183 - (21%)
Similarity:51/183 - (27%) Gaps:84/183 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GLGGFANGRPIAPGGGGGGGGAPAP-------------RPSPSGGAPPTSGPPIP---------- 135
            |:|.|.|.:............||.|             ||:.|....|.|.||.|          
  Fly   168 GIGRFENSQRFGLERPTPTAAAPPPPQQQPQRVAVIRTRPASSAALRPESPPPQPMARPRPKPVQ 232

  Fly   136 -----------------------------ILSFVNENDGDGNYRFSYETGNG-IKAQEEGT---V 167
                                         |..:..||: ||:..:.||..:| .|.:..||   .
  Fly   233 PRPIIDQNQLQDDHVDQQQQRRRQPVSQTIRKWREENE-DGSITWGYENDDGSFKEELIGTDCIT 296

  Fly   168 KNKGSENEIPSVMGSYSYTNPEGELVEIMYTA---------------DENGFV 205
            |            |:|.|.:|:|...|..|..               .|||||
  Fly   297 K------------GTYGYVDPDGNKREYHYETGIKCDPNNRNNEEELQENGFV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:278791 16/73 (22%)
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.