DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ef and Lcp4

DIOPT Version :10

Sequence 1:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:91 Identity:35/91 - (38%)
Similarity:48/91 - (52%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPEGELVEIMYTAD 200
            :...||:...|| :.......||..|...|.|..        ::.|.:.:.:||||.|.:.|.||
  Fly    22 VKELVNDVQADG-FVSKLVLDNGSAASATGDVHG--------NIDGVFEWVSPEGEHVRVSYKAD 77

  Fly   201 ENGFVPSGNALPTPPPIPEAIAKSLA 226
            |||:.|..:.|||||||||||.|::|
  Fly    78 ENGYQPQSDLLPTPPPIPEAILKAIA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 16/54 (30%)
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 16/48 (33%)

Return to query results.
Submit another query.