DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ef and CG15754

DIOPT Version :10

Sequence 1:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:121 Identity:34/121 - (28%)
Similarity:48/121 - (39%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PRPSPSGGAPPTSGPPIPIL-----------------SFVNENDGDGNYRFSYETGNGIKAQEEG 165
            |:|.|...|.|..|..:..|                 :|...|: ||:|.|.|...:||:..|:|
  Fly   151 PQPQPLPPALPQPGGVLEELAGGQVDEELEDYNAWRDNFYELNE-DGSYIFGYSIPHGIRRWEKG 214

  Fly   166 TVKNKGSENEIPSVMGSYSYTNP----EGELVEI-MYTADENGFVPSG-NALPTPP 215
            ..    ||.:...|:..: |..|    :|...|: .|.||..|:.|.. ..|.|||
  Fly   215 YY----SEEQHGRVVEGF-YVQPRHDSQGLRYELRCYRADSEGYQPRPVEFLRTPP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 17/59 (29%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.