DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ef and Cpr11B

DIOPT Version :9

Sequence 1:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:248 Identity:64/248 - (25%)
Similarity:80/248 - (32%) Gaps:98/248 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AAKLDNKYLP-PPASAASAGGSPGAGLQGPGGG--FGGGGGFGGGGAGGGYGGGGGGGPAGGFGG 78
            |.:|..:||| |.||.....|..|.|...||.|  ||||..:                       
  Fly    21 AGRLSQRYLPTPQASQLHYHGVSGQGQARPGAGHSFGGGSSY----------------------- 62

  Fly    79 GPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGGAPAPRPSPSGGAPPTSGPPIPILSFVNEN 143
                                                            .....|.|||:.....:
  Fly    63 ------------------------------------------------QRQQQPQIPIVRSDYNS 79

  Fly   144 DGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPEGELVEIMYTADENGFVPSG 208
            |.:|||.|.::|||||...|.|..:.......: .|.||||||..:|:...:.||||:|||...|
  Fly    80 DANGNYNFGFDTGNGIHRDETGEFRGGWPHGSL-GVQGSYSYTGDDGKQYTVNYTADKNGFHAEG 143

  Fly   209 NALPTPPPIPEAIAKSLAAQGISILPGGGYSGGPGGQGAGGGGGGGSGYGGGS 261
            ..||..|.:|.|.|                       |....|.|||||.|.:
  Fly   144 AHLPVSPSVPAAPA-----------------------GRSSYGAGGSGYRGSA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:278791 22/54 (41%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.