DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ef and LOC1279293

DIOPT Version :10

Sequence 1:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_318993.5 Gene:LOC1279293 / 1279293 VectorBaseID:AGAMI1_010278 Length:582 Species:Anopheles gambiae


Alignment Length:123 Identity:59/123 - (47%)
Similarity:78/123 - (63%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GGGAPAPRPSPSGGAPPTSGPPIPILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEI 176
            ||...||:      .|.|.  ||||:....|.:.||:|.:||||||||..:|:|.:||.|:|.|.
Mosquito    16 GGVECAPQ------GPATE--PIPIIRQEQEVNPDGSYSWSYETGNGIVTEEQGFLKNPGTEQEA 72

  Fly   177 PSVMGSYSYTNPEGELVEIMYTADENGFVPSGNALPTPPPIPEAIAKSLAAQGISILP 234
            ....|.||||.|:|:|:.:.|.||||||.|.|:.||||||||.||.::|  :.::.||
Mosquito    73 QVAQGEYSYTAPDGQLIRVQYIADENGFQPLGDHLPTPPPIPPAIQRAL--EYLASLP 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 29/54 (54%)
LOC1279293XP_318993.5 None

Return to query results.
Submit another query.