DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and ep300

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_004913855.2 Gene:ep300 / 734023 XenbaseID:XB-GENE-482293 Length:2492 Species:Xenopus tropicalis


Alignment Length:401 Identity:102/401 - (25%)
Similarity:133/401 - (33%) Gaps:158/401 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RPQVPPLQPLQQQANPFQRRQPNPVQG--------QGLFPGQRNPLNPLAPPLTGAALQNPYTRY 96
            ||.:.|.|  .|..||.|....||.||        .|:.||.:.|.....||.|..  |.|:.:.
 Frog  2002 RPMMNPHQ--MQPMNPMQPMGMNPQQGPRGQVHMESGIGPGMQQPQQQQQPPPTQP--QPPWVQS 2062

  Fly    97 NQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGV-----EAQVIQGSY 156
            ...|.|:..|                |...:...:...||...|:....|:     .:|..|||.
 Frog  2063 GLPQSQSMQP----------------GMQRSPIMSVPQQGQPMNMNPQSGIGQVPGASQTKQGSL 2111

  Fly   157 SYTSPEGTPITVR--------------------------------YIADENGFRAEGTG-IPSSP 188
            ...:.:....|:|                                |.:.:|   |:..| :|..|
 Frog  2112 PQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYASSQN---AQAAGNVPGMP 2173

  Fly   189 -----QYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNAPFRPQLPGQQPLTPLQQQQQQQQQQ 248
                 |....:.|..||     :||.|.     ..|.|..|.:||.|.|||         .||..
 Frog  2174 AQAGLQQVVHSNPGMQG-----MNPMQA-----IGPRPGMPQQPQAPQQQP---------PQQSP 2219

  Fly   249 LQQQ--RGFQQQQQP---NSGQYQPEQPFNQLHSGNLPGQYAGQFGQQSFGSNLTAQQAQQQQNL 308
            |.||  .|...|.||   |.|...|:  |.::                    .|..||..|||  
 Frog  2220 LPQQAMAGINPQGQPLNINPGGISPQ--FREI--------------------ILRRQQIMQQQ-- 2260

  Fly   309 NQQQQQQQQQQQQQQQQQKEQ----------------------QNEQQQQAL------------- 338
             |||||||||||||||||::|                      |.:||||..             
 Frog  2261 -QQQQQQQQQQQQQQQQQQQQGAGPGMVNHNQFQQHQVMSGYTQQQQQQQRFQHHIQMQQGSMGQ 2324

  Fly   339 ITQQLRGRPNN 349
            ::|..:|.|.:
 Frog  2325 MSQMPQGMPGD 2335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 13/93 (14%)
ep300XP_004913855.2 zf-TAZ 347..414 CDD:396624
KIX 563..643 CDD:366953
Med15 <650..>877 CDD:312941
PHA03247 <777..982 CDD:223021
Bromo_cbp_like 1080..1194 CDD:99927
RING_CBP-p300 1206..1288 CDD:276805
PHD_p300 1289..1323 CDD:277116
HAT_KAT11 1352..1658 CDD:400497
ZZ_CBP 1714..1754 CDD:239077
zf-TAZ 1781..1849 CDD:396624
Med15 1954..>2451 CDD:312941 102/401 (25%)
Creb_binding 2059..2161 CDD:401102 15/117 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.