DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr65Ax1

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:84 Identity:31/84 - (36%)
Similarity:50/84 - (59%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVR 169
            |.:....:.:.:| ::||...::|||:...:|.:||.  |..:||....||:||..|:|...||.
  Fly    20 VEVLRSDSNVGID-NYSYAVETSDGTSKSEEGVLKNA--GTELEAISTHGSFSYVGPDGQTYTVT 81

  Fly   170 YIADENGFRAEGTGIPSSP 188
            |:||||||:.:|..:|.:|
  Fly    82 YVADENGFQPQGAHLPVAP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 24/56 (43%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.