DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cpr47Ee and CPR123

DIOPT Version :9

Sequence 1:	NP_610659.1	Gene:	Cpr47Ee / 36193	FlyBaseID:	FBgn0033602	Length:	369	Species:	Drosophila melanogaster
Sequence 2:	XP_001688325.1	Gene:	CPR123 / 5667565	VectorBaseID:	AGAP003385	Length:	155	Species:	Anopheles gambiae

Alignment Length:	76	Identity:	26/76 - (34%)
Similarity:	34/76 - (44%)	Gaps:	8/76 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   106 PITA-YQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVR 169
            |:.| ..::.:.:..:||.|..||..|..      |....|.....|:.||||...|:||...|.
Mosquito    38 PVVAKVADDYDPNPQYSYSYHIADALTGD------NKEQQESRSGDVVTGSYSLVEPDGTRRVVE 96

  Fly   170 YIADE-NGFRA 179
            |.||. |||.|
Mosquito    97 YTADPVNGFNA 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cpr47Ee	NP_610659.1	Chitin_bind_4	120..177	CDD:278791	21/57 (37%)
CPR123	XP_001688325.1	Chitin_bind_4	53..105	CDD:278791	21/57 (37%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910