DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR47

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_001688131.1 Gene:CPR47 / 5667289 VectorBaseID:AGAP006848 Length:118 Species:Anopheles gambiae


Alignment Length:104 Identity:24/104 - (23%)
Similarity:43/104 - (41%) Gaps:20/104 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYS 157
            |..::: :.::|.....|:        |.||.........::|..|:        :..|::|.||
Mosquito    29 YAHHHE-EPKDYYAYPKYK--------FEYGVKDPHTGDHKSQWEVR--------DGDVVKGQYS 76

  Fly   158 YTSPEGTPITVRYIADE-NGFRA--EGTGIPSSPQYFAG 193
            ....:||...|.|.:|: :||.|  :..|....||.:.|
Mosquito    77 LHEADGTERVVEYKSDKHSGFEAVVKKVGHAHHPQVYGG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 14/57 (25%)
CPR47XP_001688131.1 Chitin_bind_4 45..97 CDD:278791 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.