powered by:
Protein Alignment Cpr47Ee and CPR102
DIOPT Version :9
Sequence 1: | NP_610659.1 |
Gene: | Cpr47Ee / 36193 |
FlyBaseID: | FBgn0033602 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001237743.2 |
Gene: | CPR102 / 4576295 |
VectorBaseID: | AGAP006004 |
Length: | 124 |
Species: | Anopheles gambiae |
Alignment Length: | 72 |
Identity: | 24/72 - (33%) |
Similarity: | 40/72 - (55%) |
Gaps: | 6/72 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 ITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYI 171
:.:|:| ::.|..:.:.|.:.|| ||:..|..:....|| ..:.|.|||.:|:|....|.::
Mosquito 27 LISYEN-VHTDNGYRFSYETKDG---QAREEVGTIDPSTGV--LTVTGWYSYRTPDGATQRVDFV 85
Fly 172 ADENGFR 178
|||||:|
Mosquito 86 ADENGYR 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.