DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr97Ea

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:379 Identity:86/379 - (22%)
Similarity:125/379 - (32%) Gaps:114/379 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WVACLLASLWFSVSQAQLPGTGFQGQRPQVPPLQPLQQQANPFQRRQPNPVQGQGLFPGQRNPLN 78
            :|.||:..:....||      .:|..:...|...||:.:||                        
  Fly     9 FVGCLIVGVGMVRSQ------DYQDYQENTPRTAPLRLRAN------------------------ 43

  Fly    79 PLAPPLTGAALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGT----TAQAQGYVK 139
             .||....|...:|            |.|....|:.|.|||::|||..|||:    |..|.|.||
  Fly    44 -AAPARAEAPRADP------------VAILKQINKHNEDGSYTYGYEGADGSFKIETKLATGEVK 95

  Fly   140 NLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNP 204
                          |.|.|....|....|.|.|::.||:..|.||..:|          ..|::.
  Fly    96 --------------GKYGYVDETGKVRVVEYGANKYGFQPSGEGITVAP----------PTLVDE 136

  Fly   205 NLNPYQTPFRQLPPPLPNAPFRPQLPGQQPLTPLQQQQQQQQQQLQQQRGFQQQQQPNSGQYQP- 268
            .|........:..|..|..|:|.|.|  ||....:.|.|.|.|.:|.:   .:::.|...||.| 
  Fly   137 TLKEEPDYADEPAPQRPQKPYRVQRP--QPRPQPRPQPQPQPQYVQYE---VEEESPRRVQYAPA 196

  Fly   269 ----EQPFNQLHSGNLPGQYAGQFGQQSFG---SNLTAQQAQQQQNLNQQQQQQQQQQQQQQQQQ 326
                .||..|      |.....|..|.|.|   ..|....||:..::.....|:..:.:....|.
  Fly   197 PQPQPQPLPQ------PQHLPQQHHQPSVGPAPPRLQVPGAQRTTDVLYSPLQRPARPEPDYSQT 255

  Fly   327 KE----------------------QQNEQQQQALITQQLRGRPNNLVDPYGYNQ 358
            :.                      ..:..:.|..:.....|||  |::|.|:.|
  Fly   256 QSFGDGPSNVRISRPVYALPPASPAPSSARAQGFLAPASGGRP--LLEPVGFGQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 18/60 (30%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.