powered by:
Protein Alignment Cpr47Ee and Cpr78Ca
DIOPT Version :9
Sequence 1: | NP_610659.1 |
Gene: | Cpr47Ee / 36193 |
FlyBaseID: | FBgn0033602 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649298.2 |
Gene: | Cpr78Ca / 40352 |
FlyBaseID: | FBgn0037067 |
Length: | 127 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 36/71 - (50%) |
Gaps: | 11/71 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 GSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGT 182
|.:|:.:.:.:|.|.:..| .|.....|:| :.||||.|:|..|:||.||::..|.
Fly 44 GHYSFEFQTTNGITTKGAG-------NENGAVGVVQ----FVSPEGIPVTFSYVADANGYQPTGD 97
Fly 183 GIPSSP 188
.||:.|
Fly 98 HIPAIP 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1459720at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.020 |
|
Return to query results.
Submit another query.