DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr72Ea

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:116 Identity:35/116 - (30%)
Similarity:47/116 - (40%) Gaps:33/116 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PLAPPLTGAALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYS---SADGTTAQAQGYVKN 140
            |.|....|:|:..|       .|:.|:.    ::||   |.:|||||   |:...|....|    
  Fly    22 PYAYTAEGSAVFTP-------TQRQYIA----KDEL---GQYSYGYSEPLSSKQETRTLDG---- 68

  Fly   141 LGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSS--PQ 189
                      :.||.|||....|...||.|:||..||....|.:|.:  ||
  Fly    69 ----------ITQGYYSYRDAAGKLQTVNYVADNKGFHVAATNLPKAKVPQ 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 19/59 (32%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.