DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr67Fb

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:101 Identity:39/101 - (38%)
Similarity:57/101 - (56%) Gaps:19/101 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIA 172
            |.|:||:..|||:|:.|.:::|..||..|    :|   ||:|   .||.||.:|:||||.:.|.|
  Fly    27 TKYRNEIKPDGSYSWEYGTSNGIDAQESG----VG---GVQA---AGSVSYAAPDGTPIQLEYTA 81

  Fly   173 DENGFRAEGTGIPSSPQY---------FAGAQPYQQ 199
            ||||:|..|..:|:.|..         :..|.|:|:
  Fly    82 DENGYRPTGAHLPTPPPIPDYILKALAYIEAHPFQR 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 24/56 (43%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:278791 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.