DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr65Eb

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:174 Identity:41/174 - (23%)
Similarity:64/174 - (36%) Gaps:50/174 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YVPITAYQNELNL-DGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPIT 167
            :..|.::.|||.. ||.::|.:.:::|...|.|          ||......||..|.:|||..|.
  Fly    29 HAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQ----------GVGGYYASGSSQYYTPEGQLIQ 83

  Fly   168 VRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNAPFR------ 226
            :.|.||||||:.:|..:|:                              |.|:|.|..:      
  Fly    84 LTYTADENGFQPQGEHLPT------------------------------PHPIPEAILKSLEYNR 118

  Fly   227 --PQLPGQQPLTPLQQQQQQQQQQLQQQRGFQQQQQPNSGQYQP 268
              |:..|:...........:..|...|::| :|..||......|
  Fly   119 NHPEEDGEYEHHDHHHDHHEHHQSHGQEQG-KQYLQPAGALLAP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 18/56 (32%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.