DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr65Ea

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:170 Identity:47/170 - (27%)
Similarity:62/170 - (36%) Gaps:51/170 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LAPPLTGAALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYG 144
            |...|.|.||..|.         |...||.:....:.||:::|....|.|...:.:|..      
  Fly     6 LVVALFGCALAAPL---------NDDTITKFLANQDTDGTYAYDIEQASGIQIKEEGLA------ 55

  Fly   145 EGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPY 209
             |.||   .|||||.||||.|:.|.|.|||.||..:...:|:                       
  Fly    56 -GHEA---HGSYSYISPEGIPVQVVYTADEFGFHPQSNLLPT----------------------- 93

  Fly   210 QTPFRQLPPPLPNAPFRPQLPGQQPLTP--LQQQQQQQQQ 247
                   |||:|....|.....|:..||  |..:..:.||
  Fly    94 -------PPPIPEEILRSIRYIQEHPTPEELADRAVRAQQ 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 22/56 (39%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.