DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr65Az

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:179 Identity:62/179 - (34%)
Similarity:84/179 - (46%) Gaps:28/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AQLPGTGFQGQRPQVPPLQPLQQQANPFQRRQPNPVQGQGLFPGQRNPLNPL----APPLTGAAL 89
            |:.|.|....:.|..||..|....||.:    ..|.:|.|..|    |..|.    .||..|...
  Fly    27 ARPPATYLPVKPPAPPPRPPPPAPANSY----GPPKKGNGKPP----PAPPKPSYGPPPKNGNGK 83

  Fly    90 QNPYTRYNQYQQQN---------------YVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVK 139
            ..|...|......|               .:||...::::|.|||:.|.|.:.:|..|:..||:|
  Fly    84 PPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLK 148

  Fly   140 NLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSP 188
            |.|. ||.|||..:||:|||||||..|::.||||||||:.:|..:|:.|
  Fly   149 NAGV-EGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTPP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 30/56 (54%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I15492
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.