DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:82 Identity:31/82 - (37%)
Similarity:53/82 - (64%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYI 171
            |...::::..:| :::...::||...:.||.:||:|..:  ||.|::||||:.:.:|...||.||
  Fly    28 ILRLESDVQPEG-YNFALETSDGKKHEEQGQLKNVGTEQ--EAIVVRGSYSFVADDGQTYTVNYI 89

  Fly   172 ADENGFRAEGTGIPSSP 188
            ||||||:.||..:|:.|
  Fly    90 ADENGFQPEGAHLPNVP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:459790 23/56 (41%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 23/56 (41%)

Return to query results.
Submit another query.