DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Lcp65Ag2

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:70 Identity:27/70 - (38%)
Similarity:42/70 - (60%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTG 183
            ||.|.:.::||..|||.|.:.::|...  ||..:.|||.:.:.:|....|.||||:|||:.:|..
  Fly    36 SFKYDWETSDGQAAQAVGQLNDIGTEN--EAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAH 98

  Fly   184 IPSSP 188
            :|.:|
  Fly    99 LPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 21/56 (38%)
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:306811 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.