DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and frm

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001137887.1 Gene:frm / 38624 FlyBaseID:FBgn0035612 Length:1180 Species:Drosophila melanogaster


Alignment Length:388 Identity:76/388 - (19%)
Similarity:106/388 - (27%) Gaps:163/388 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PG-TGFQGQRPQVPPLQPLQQQANPFQRRQPNPVQGQGLFPGQRNPLNPLAPPLTGAALQNPYTR 95
            || .|..|.....||..|     .|.:...|.|.:     ||...|..| .||  |.:..:|  |
  Fly   610 PGPPGPPGPTRPGPPGPP-----GPTRPGPPGPTR-----PGPPGPTRP-GPP--GPSPNDP--R 659

  Fly    96 YNQYQQQNYVPITAYQNELNLDGSFSY---GYSSA----DGTTAQAQGYVKNLGYGEGVEAQVIQ 153
            |:..:...|:|       .|..|..|.   .||..    ...|.....|.:|             
  Fly   660 YSDKETPGYLP-------PNQPGKISKPPPSYSQVIEIEPPKTVYKPNYEQN------------- 704

  Fly   154 GSYSYTSPEGT---PITVRYIADENGFRAEGTGIPSSPQYFAGA-----QPYQQGLLNPNLNP-- 208
            ..|:...|..|   |:|  ||.         ...|::|:.:..|     ||..|.:....:.|  
  Fly   705 NDYAIKKPSVTTKPPLT--YIP---------PSFPNTPKPYVPAPVPAPQPPSQKITTTIVQPKV 758

  Fly   209 -------------YQTP---------FRQLPPPLPN------------------AP----FRPQL 229
                         ..||         ...||||.|.                  ||    :.|..
  Fly   759 PAITIEKDKPNKSVTTPPVTTGNIENHTYLPPPPPTPKYVTKTKTPTPIPVPTPAPIPIQYEPST 823

  Fly   230 PGQQPLTPLQQQQQQQQQQLQQQRGFQQQQQPNSGQYQP--------------EQPFNQLH---- 276
            |  :|...:..:..|.|....|.......:||.:..|:|              .:|...||    
  Fly   824 P--RPFEKVVTKLPQIQYHTPQVPTVVVPKQPVTVPYKPVTRPPTVYVEPKVTPRPSPPLHVPSI 886

  Fly   277 ---------------------------SGNLPG--------QYAGQFGQQSFGSNLTAQQAQQ 304
                                       :.:.|.        |::|..||.:|||.:.|....|
  Fly   887 SDQSCVCNADKTHSSKSTLTSTTTTTTTNSYPNPASVDFNKQFSGFNGQANFGSIINAMSLTQ 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 13/66 (20%)
frmNP_001137887.1 Chitin_bind_4 54..102 CDD:278791
MttA_Hcf106 <1046..1128 CDD:294511
L12 1051..1159 CDD:273301
HHH_5 1092..>1168 CDD:304555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.