Sequence 1: | NP_610659.1 | Gene: | Cpr47Ee / 36193 | FlyBaseID: | FBgn0033602 | Length: | 369 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611470.1 | Gene: | Cpr56F / 37299 | FlyBaseID: | FBgn0034499 | Length: | 217 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 69/207 - (33%) | Gaps: | 67/207 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 FRHLRWVACLLASLWFSVSQAQLPGTGFQGQRPQVPPLQPLQQQANPFQRRQPNPVQG-----QG 68
Fly 69 LFPGQR------NPLN----PLAPP--------LTGAALQNPY--------------TRYNQYQQ 101
Fly 102 QNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPI 166
Fly 167 TVRYIADENGFR 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr47Ee | NP_610659.1 | Chitin_bind_4 | 120..177 | CDD:278791 | 13/56 (23%) |
Cpr56F | NP_611470.1 | Chitin_bind_4 | 128..179 | CDD:278791 | 13/56 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |