DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr56F

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:207 Identity:48/207 - (23%)
Similarity:69/207 - (33%) Gaps:67/207 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FRHLRWVACLLASLWFSVSQAQLPGTGFQGQRPQVPPLQPLQQQANPFQRRQPNPVQG-----QG 68
            |..:..:.||.|  |   :.|:.|    ..|...:||.|..|..:|.:.    .|.||     ..
  Fly     4 FTSIALLVCLAA--W---THAEPP----VPQNQYLPPNQSPQAPSNNYL----PPTQGYQSPSSN 55

  Fly    69 LFPGQR------NPLN----PLAPP--------LTGAALQNPY--------------TRYNQYQQ 101
            ..|.||      .|.|    |:|||        ||||..:...              ..|.|..:
  Fly    56 YLPPQRAGGNGGAPSNSYGAPIAPPQGQYGAPALTGAIFKGGNGNGNGGYGGGNGNGNGYGQRDE 120

  Fly   102 QNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPI 166
            :.|.|           ..:.:.|...|..:.      .:.|:.|..:..:..|.|....|:|...
  Fly   121 EQYGP-----------AKYEFKYDVQDYESG------NDFGHMESRDGDLAVGRYYVLLPDGRKQ 168

  Fly   167 TVRYIADENGFR 178
            .|.|.||:||:|
  Fly   169 IVEYEADQNGYR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 13/56 (23%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.