DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr49Ad

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:150 Identity:49/150 - (32%)
Similarity:77/150 - (51%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QQQANPFQRRQPNPVQGQGLFPGQRNPLNPLAPPLTGAALQNPYTRYNQYQQQNYVPITAYQNEL 114
            |.|.||:.|   ||.. :.|:...|:..| |.....|.     |.:||.|.......|....|::
  Fly    22 QPQYNPYLR---NPYY-RDLYYRNRDLYN-LRRFYDGF-----YKKYNPYIAAAQARIVEQNNDV 76

  Fly   115 NLD-GSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFR 178
            |.. ||:||.|.:.:|...:.:|...|:|..:  :.:.::|:||:.:|||..:.|:|:||.||||
  Fly    77 NYGAGSYSYNYETENGIHGEERGVPVNIGNQQ--QEEQVEGAYSFITPEGLRVGVKYLADANGFR 139

  Fly   179 AEGT--GIPSSPQYFAGAQP 196
            ...|  |:.|:  ::|| ||
  Fly   140 PVITYDGVNSA--FYAG-QP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 18/56 (32%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.