DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR135

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_556966.3 Gene:CPR135 / 3290137 VectorBaseID:AGAP006261 Length:256 Species:Anopheles gambiae


Alignment Length:240 Identity:60/240 - (25%)
Similarity:89/240 - (37%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QAQLPGTGFQGQRPQVPPLQPLQQQANP-FQRRQPNPVQGQGLFPGQRNPLNPLAPPLTGAALQN 91
            |..:|....|||..:....||..:|..| :|.:|...||.|           ....|.....:..
Mosquito    62 QQHIPQYLPQGQPQRTQYQQPQARQYQPQYQPQQIQYVQEQ-----------QYQQPQPQLKVSK 115

  Fly    92 PYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSY 156
            |..:|.|..|:.  |:...|.:.:.:.|:.:|:...|......|      ...|..:..||:|||
Mosquito   116 PRPQYLQGGQKQ--PLEEEQEDYDANPSYQFGFDVKDDEFTNYQ------NRKEQRDGNVIKGSY 172

  Fly   157 SYTSPEGTPITVRYIAD-ENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPL 220
            |....:|...||.|.|| :.||:||.:..|:....                        ::|.|.
Mosquito   173 SVVDSDGFIRTVTYTADPKEGFKAEVSRQPTDIVV------------------------KIPTPA 213

  Fly   221 PNAPF-----RPQLPGQQPLTPLQQQQQQQQQQLQQQRGFQQQQQ 260
            |.:..     :||..|...:    |||.|||||.|.:...|:..|
Mosquito   214 PQSQHDRFASQPQSAGAYRV----QQQPQQQQQAQPRPRPQEYSQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 16/57 (28%)
CPR135XP_556966.3 Chitin_bind_4 142..194 CDD:278791 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.