DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR105

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_556684.2 Gene:CPR105 / 3290086 VectorBaseID:AGAP006010 Length:105 Species:Anopheles gambiae


Alignment Length:65 Identity:26/65 - (40%)
Similarity:33/65 - (50%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LDGSFSYGYSSADGTTAQAQGY---VKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGF 177
            :|||:|:.|...|....:....   |||.. .|.|.|..|.|.|.:|.|:|....|:|.||||||
Mosquito    35 VDGSYSFSYDQTDDHKREESAVLKTVKNFD-NEDVPALTITGQYEFTDPDGKRYLVKYTADENGF 98

  Fly   178  177
            Mosquito    99  98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 21/59 (36%)
CPR105XP_556684.2 Chitin_bind_4 39..98 CDD:278791 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.