DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR28

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_556681.3 Gene:CPR28 / 3290082 VectorBaseID:AGAP006007 Length:116 Species:Anopheles gambiae


Alignment Length:121 Identity:31/121 - (25%)
Similarity:44/121 - (36%) Gaps:44/121 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQ--GSYSYTSPEGTPITV 168
            |...|.:.:..|..:.|.|.:.||.:.:.|||:       ..|:.:::  |||.|...:|....|
Mosquito    26 PDILYYDNVRDDQGYFYSYKTKDGQSRREQGYI-------DPESGILRVTGSYKYIGTDGETYEV 83

  Fly   169 RYIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNAP 224
            .|.|||||:|..|                                   .||||.||
Mosquito    84 YYEADENGYRIVG-----------------------------------KPPLPGAP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 19/58 (33%)
CPR28XP_556681.3 Chitin_bind_4 40..92 CDD:278791 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.