DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and Cpr11B

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:181 Identity:55/181 - (30%)
Similarity:76/181 - (41%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QRRQPNP---------VQGQGLFPGQRNPLNPLAPPLTGAALQNPYTRYNQYQQQNYVPITAYQN 112
            ||..|.|         |.||    ||..|         ||..........|.|||..:||.....
  Fly    26 QRYLPTPQASQLHYHGVSGQ----GQARP---------GAGHSFGGGSSYQRQQQPQIPIVRSDY 77

  Fly   113 ELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGF 177
            ..:.:|::::|:.:.:|......|..:. |:..|  :..:|||||||..:|...||.|.||:|||
  Fly    78 NSDANGNYNFGFDTGNGIHRDETGEFRG-GWPHG--SLGVQGSYSYTGDDGKQYTVNYTADKNGF 139

  Fly   178 RAEGTGIPSSP----------QYFAGAQPYQQGLLNPNLNPYQTPFRQLPP 218
            .|||..:|.||          .|.||...| :|..:.::.......|.|||
  Fly   140 HAEGAHLPVSPSVPAAPAGRSSYGAGGSGY-RGSASSHVPAAAPATRYLPP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 19/56 (34%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.