DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CG42367

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:76 Identity:22/76 - (28%)
Similarity:33/76 - (43%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ITAYQNELNLD-GSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRY 170
            |.::.:||... ..:.:.||..|..:    |.||:  ..|....:.:.|.||...|:|....|.|
  Fly    25 IASHPDELIASPAQYEFHYSVHDSHS----GDVKD--QFEHRRGEYVTGRYSLVDPDGHRRIVDY 83

  Fly   171 IADE-NGFRAE 180
            .||. .||.|:
  Fly    84 TADPLLGFNAQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 16/57 (28%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.