powered by:
Protein Alignment Cpr47Ee and Cpr60D
DIOPT Version :9
Sequence 1: | NP_610659.1 |
Gene: | Cpr47Ee / 36193 |
FlyBaseID: | FBgn0033602 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286853.1 |
Gene: | Cpr60D / 246492 |
FlyBaseID: | FBgn0050163 |
Length: | 93 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 23/69 - (33%) |
Similarity: | 31/69 - (44%) |
Gaps: | 13/69 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 111 QNELNLDGS--FSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIAD 173
:|..||||: |.:..:.::|...:|||.|.. |||.|.....:|..|.|.|.||
Fly 30 ENRQNLDGAGQFQHEITVSNGIQVKAQGNVNG-----------IQGEYFLPGEDGKQIRVTYTAD 83
Fly 174 ENGF 177
..||
Fly 84 ATGF 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.