DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR110

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_319711.4 Gene:CPR110 / 1279926 VectorBaseID:AGAP008960 Length:188 Species:Anopheles gambiae


Alignment Length:68 Identity:24/68 - (35%)
Similarity:30/68 - (44%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADE-NG 176
            |.:....:|:.|...|..|..      |....|..:..|:||.||...|:||..||.|.||. ||
Mosquito    33 EYDAHPQYSFSYDVQDSLTGD------NKQQHETRDGDVVQGQYSLVEPDGTRRTVDYTADPVNG 91

  Fly   177 FRA 179
            |.|
Mosquito    92 FNA 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 20/57 (35%)
CPR110XP_319711.4 Chitin_bind_4 40..92 CDD:278791 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.