DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR81

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_318999.3 Gene:CPR81 / 1279298 VectorBaseID:AGAP009879 Length:131 Species:Anopheles gambiae


Alignment Length:179 Identity:60/179 - (33%)
Similarity:85/179 - (47%) Gaps:57/179 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LRWVACLLASLWFSVSQAQLPGTGFQGQRPQVPPLQPLQQQANPFQRRQPNPVQGQGLFPGQRNP 76
            :::|..|:|:|..:.|             .|:.||              |.|::..|::.|    
Mosquito     1 MKFVVLLVAALVAATS-------------AQIRPL--------------PIPLRNPGVYGG---- 34

  Fly    77 LNPLAPPLTGAALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNL 141
                  |...|.:.|          |.|.|        |.|||:.|.|.:::|..|..:|::|| 
Mosquito    35 ------PEASAVILN----------QVYEP--------NPDGSYVYSYETSNGIRADQRGFLKN- 74

  Fly   142 GYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQY 190
             .|...||||:|||||||.|:|...|:.|||||||:||||..|||:|:|
Mosquito    75 -PGTPGEAQVMQGSYSYTGPDGVVYTINYIADENGYRAEGAHIPSAPRY 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 28/56 (50%)
CPR81XP_318999.3 Chitin_bind_4 54..109 CDD:278791 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.