DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR77

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_318995.4 Gene:CPR77 / 1279294 VectorBaseID:AGAP009875 Length:126 Species:Anopheles gambiae


Alignment Length:111 Identity:42/111 - (37%)
Similarity:59/111 - (53%) Gaps:33/111 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGF 177
            |:|.||::.|.|.:::|..|:.||.:||||   ..:|||.||.||||.|||..::|:||||||||
Mosquito    30 EVNPDGTYQYAYETSNGIVAEEQGTLKNLG---EEQAQVAQGQYSYTDPEGNRVSVQYIADENGF 91

  Fly   178 RAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNA 223
            :.:|..:|:                              |||:|.|
Mosquito    92 QPQGDHLPT------------------------------PPPIPEA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 29/56 (52%)
CPR77XP_318995.4 Chitin_bind_4 37..91 CDD:278791 29/56 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.