DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR76

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_318993.4 Gene:CPR76 / 1279293 VectorBaseID:AGAP009874 Length:268 Species:Anopheles gambiae


Alignment Length:156 Identity:45/156 - (28%)
Similarity:63/156 - (40%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GQGLFPGQRNPLNPL-------APPLTGAALQNPYTRYNQYQQQNYVPITAY----------QNE 113
            |.|......||..|.       |||.|      |.....:..|....|..||          :|:
Mosquito   123 GAGANAADTNPPKPATTTSAPSAPPPT------PVPTLARIAQVKVAPKPAYAPDGWKIIRLENQ 181

  Fly   114 LNLDGSFSYGYSSADGTTAQAQGYVKNLG-YGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGF 177
            :..|| :.|.:.:.:|..|:..|.:::.| ..||:.:   ||.|.|...:|....|.|:||.|||
Mosquito   182 VENDG-YHYVFETENGILAEEAGRIEDKGTAAEGLRS---QGFYQYVGDDGVVYRVDYVADGNGF 242

  Fly   178 RAEGTGIPSSP-------QYFAGAQP 196
            ..:|..||..|       :|.| |||
Mosquito   243 LPQGDHIPKVPPAIEKLLKYLA-AQP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 17/57 (30%)
CPR76XP_318993.4 Chitin_bind_4 187..242 CDD:278791 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.