DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR73

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_318986.3 Gene:CPR73 / 1279287 VectorBaseID:AGAP009868 Length:166 Species:Anopheles gambiae


Alignment Length:202 Identity:49/202 - (24%)
Similarity:85/202 - (42%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LTGAALQNP----YTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLG-- 142
            |..:|...|    :.|:..::...|:||..|..:...|||:...|.:.:....:..||:|:..  
Mosquito     9 LVASAYAYPQHEHHERHEHHETTTYIPILKYDKQQGEDGSYRTIYQTGNNIVHEESGYLKDASED 73

  Fly   143 YGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLN 207
            :..|:..|  ||:|||.:|.|..|.|:|.|||||||.:...:|:                     
Mosquito    74 HPNGILVQ--QGAYSYEAPNGDVIQVQYTADENGFRVQSDSLPT--------------------- 115

  Fly   208 PYQTPFRQLPPPLPNAPFRPQLPGQQPLTPLQQQQQQQQQQLQQQRGF-----QQQQQPNSGQYQ 267
                     |||:|.|.       |:.|..:.:..::::|:.:....:     ::.|...:||| 
Mosquito   116 ---------PPPVPPAI-------QEGLKEIYEGIKRREQEAKNNPKYAEDEARRAQLDYNGQY- 163

  Fly   268 PEQPFNQ 274
                :||
Mosquito   164 ----YNQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 20/58 (34%)
CPR73XP_318986.3 Chitin_bind_4 49..106 CDD:278791 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.