DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR32

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_316045.2 Gene:CPR32 / 1276675 VectorBaseID:AGAP006012 Length:156 Species:Anopheles gambiae


Alignment Length:157 Identity:49/157 - (31%)
Similarity:73/157 - (46%) Gaps:46/157 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVR 169
            :||...::..:.|||:.:.|.|.:|.|||.:|:|||.| .:..|.||..||||||.|.|.|:::.
Mosquito    37 IPIVHSESYSSHDGSYKFAYESGNGITAQEEGFVKNAG-SKDHEVQVAHGSYSYTDPHGVPVSLS 100

  Fly   170 YIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNAPFRPQL----- 229
            |:||||||:.:|:.:|:                              |||:|.     :|     
Mosquito   101 YVADENGFQVQGSHVPT------------------------------PPPVPK-----ELVDAYA 130

  Fly   230 -PGQQPLTPLQQQQQQQQQQLQQQRGF 255
             ...||    |...:.:..|..||.|:
Mosquito   131 KAASQP----QSHDEPEYAQPAQQHGY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 28/56 (50%)
CPR32XP_316045.2 Chitin_bind_4 52..108 CDD:278791 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.