DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR16

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_315462.3 Gene:CPR16 / 1276152 VectorBaseID:AGAP005459 Length:136 Species:Anopheles gambiae


Alignment Length:130 Identity:40/130 - (30%)
Similarity:61/130 - (46%) Gaps:31/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 AALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQV 151
            |..|||         .....:.:..:.:|.|||:.:.|.:::|..||.|          ||..|.
Mosquito    14 AVAQNP---------DADAQVLSSDSVVNPDGSYQWNYETSNGIRAQEQ----------GVGGQS 59

  Fly   152 IQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSS---PQY------FAGAQPYQQGLLNPNLN 207
            .|||.|:|..:||||::.|:|||||::.:|..:|..   |.:      |..|.|.:.   :||.|
Mosquito    60 AQGSASWTDRDGTPISLTYVADENGYQPQGDHLPREGPVPAHVLKTLEFIRANPPKD---DPNFN 121

  Fly   208  207
            Mosquito   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 22/56 (39%)
CPR16XP_315462.3 Chitin_bind_4 38..85 CDD:278791 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.