DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR127

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_003436975.1 Gene:CPR127 / 1271915 VectorBaseID:AGAP000344 Length:224 Species:Anopheles gambiae


Alignment Length:294 Identity:78/294 - (26%)
Similarity:96/294 - (32%) Gaps:88/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LAPPLTGAALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYG 144
            |:..:|..|.|..||        ..|||....|..|.|||:||||.:||||......|..    |
Mosquito     7 LSAIVTIIAAQRDYT--------TPVPILKQINRHNEDGSYSYGYEAADGTFKIETKYPN----G 59

  Fly   145 EGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFA-------GAQPYQQGLL 202
            |      :||.|.|....|....:.|.|...||..:||.|...|...:       |......|..
Mosquito    60 E------VQGKYGYVDDGGKLREIEYGASNRGFEPQGTDINVPPPTLSNSNYPPLGPNEEDDGQY 118

  Fly   203 NPNLNPYQTPFRQLPPPLP-NAPFRPQLPGQQPLTPLQQQQQQQQQQLQQQRGFQQQQQPNSGQY 266
            ..:.:.|....|....|.| |||    .|.....:|..||..:.        ...|.:|| :..|
Mosquito   119 REDPSIYYKDSRYNSKPAPYNAP----RPAPVAYSPAPQQYYRD--------AASQPEQP-ATSY 170

  Fly   267 QPEQPFNQLHSGNLPGQYAGQFGQQSFGSNLTAQQAQQQQNLNQQQQQQQQQQQQQQQQQKEQQN 331
            ||:..|                                        |.|.|..||||||..:|..
Mosquito   171 QPQHRF----------------------------------------QPQPQHHQQQQQQYYQQPA 195

  Fly   332 EQQQQALITQQLRGRPNNLVD----PYGYNQYGR 361
            ..|.:|.|     ..||..||    .|..:..||
Mosquito   196 VPQHRADI-----WHPNAKVDINTGSYSLSYTGR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 18/56 (32%)
CPR127XP_003436975.1 Chitin_bind_4 39..86 CDD:278791 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.