powered by:
Protein Alignment Cpr47Ee and CPR50
DIOPT Version :9
Sequence 1: | NP_610659.1 |
Gene: | Cpr47Ee / 36193 |
FlyBaseID: | FBgn0033602 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_308903.4 |
Gene: | CPR50 / 1270224 |
VectorBaseID: | AGAP006845 |
Length: | 139 |
Species: | Anopheles gambiae |
Alignment Length: | 75 |
Identity: | 20/75 - (26%) |
Similarity: | 30/75 - (40%) |
Gaps: | 14/75 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 FSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIAD-ENGFRAEGTG 183
|.||.........:.|..|: :..|::|.|:....:||...|.|.:| .|||.|:...
Mosquito 36 FEYGVKDPHTGDHKTQWEVR--------DGDVVKGQYTLHEADGTERVVDYKSDGHNGFEADVKK 92
Fly 184 I-----PSSP 188
: ||.|
Mosquito 93 VGHAHHPSHP 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.