powered by:
Protein Alignment Cpr47Ee and CPR61
DIOPT Version :9
Sequence 1: | NP_610659.1 |
Gene: | Cpr47Ee / 36193 |
FlyBaseID: | FBgn0033602 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001688064.1 |
Gene: | CPR61 / 1270062 |
VectorBaseID: | AGAP007040 |
Length: | 150 |
Species: | Anopheles gambiae |
Alignment Length: | 75 |
Identity: | 24/75 - (32%) |
Similarity: | 43/75 - (57%) |
Gaps: | 10/75 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 LNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFR 178
:|.|||::|.:.:::|..|||.. .:|:.. .|.:||.:|:|:.|.:.|:||:.||:
Mosquito 46 INDDGSYNYVFETSNGIRAQASS-------SDGIRT---SGDFSYPAPDGSNIALVYVADDYGFQ 100
Fly 179 AEGTGIPSSP 188
.:|..:|..|
Mosquito 101 PQGAHLPVEP 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2EQ63 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1459720at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.