DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR61

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_001688064.1 Gene:CPR61 / 1270062 VectorBaseID:AGAP007040 Length:150 Species:Anopheles gambiae


Alignment Length:75 Identity:24/75 - (32%)
Similarity:43/75 - (57%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFR 178
            :|.|||::|.:.:::|..|||..       .:|:..   .|.:||.:|:|:.|.:.|:||:.||:
Mosquito    46 INDDGSYNYVFETSNGIRAQASS-------SDGIRT---SGDFSYPAPDGSNIALVYVADDYGFQ 100

  Fly   179 AEGTGIPSSP 188
            .:|..:|..|
Mosquito   101 PQGAHLPVEP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 15/56 (27%)
CPR61XP_001688064.1 Chitin_bind_4 52..99 CDD:278791 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.