DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR62

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_308723.3 Gene:CPR62 / 1270060 VectorBaseID:AGAP007042 Length:150 Species:Anopheles gambiae


Alignment Length:89 Identity:29/89 - (32%)
Similarity:42/89 - (47%) Gaps:20/89 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 QQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGT 164
            |:||:.|          .|:::|.|.:::|..||...|       :|..|   .|.||||.|:|.
Mosquito    42 QEQNHDP----------SGAYNYRYETSNGIAAQQTSY-------DGANA---AGEYSYTGPDGV 86

  Fly   165 PITVRYIADENGFRAEGTGIPSSP 188
            ...|.|.||..||:.:|..:|..|
Mosquito    87 LYRVAYNADTYGFQPQGAHLPVEP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 19/56 (34%)
CPR62XP_308723.3 Chitin_bind_4 52..99 CDD:278791 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.