DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ee and CPR156

DIOPT Version :9

Sequence 1:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_003436895.1 Gene:CPR156 / 11175848 VectorBaseID:AGAP013337 Length:125 Species:Anopheles gambiae


Alignment Length:94 Identity:23/94 - (24%)
Similarity:34/94 - (36%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QNPYTRYNQYQQQNYVPITAYQNELNLDG--SFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVI 152
            ||.|..:|..|..    :..|.::....|  .:.|.|...|..|....      |..|..:....
Mosquito    18 QNHYGTHNDAQHD----VVHYHHDEEHHGPAHYEYHYDVHDDHTGDVH------GQHEARKDDST 72

  Fly   153 QGSYSYTSPEGTPITVRY-IADENGFRAE 180
            .|.|.....:|...||:| :..::||.||
Mosquito    73 HGEYYLIDADGHKRTVKYHVEGKSGFIAE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 12/57 (21%)
CPR156XP_003436895.1 Chitin_bind_4 46..98 CDD:278791 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.