DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:60 Identity:25/60 - (41%)
Similarity:39/60 - (65%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLP 101
            |:.:.:|::||...:.:|.: :|..|.::.:.|||.||:|.|.||..:|.|.||||||.|
  Fly    36 SFKYDWETSDGQAAQAVGQL-NDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 21/55 (38%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.