DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr65Ax2

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_652660.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster


Alignment Length:74 Identity:23/74 - (31%)
Similarity:41/74 - (55%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRY 92
            |.:|:| ...:...:|.::.|::|||.:.|.|:: .::.|..:.:...|.:.|:...||...|.|
  Fly    20 VEVLRS-DSNVGIDNYSYAVETSDGTSKSEEGVL-KNAGTELEAISTHGSFSYVGPDGQTYTVTY 82

  Fly    93 TADKNGFLP 101
            .||:|||.|
  Fly    83 VADENGFQP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 17/55 (31%)
Cpr65Ax2NP_652660.1 Chitin_bind_4 34..89 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.