DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Lcp65Ae

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:60 Identity:23/60 - (38%)
Similarity:35/60 - (58%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLP 101
            ::.:|||::||......|.:...: |..:.|.|.|.:|::.|.||..||.|.||:|||.|
  Fly    32 NFQWSFETSDGQAANAKGQLKYPN-TDHESLAVQGSFRFVADDGQTYEVNYIADENGFQP 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 20/55 (36%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:459790 20/55 (36%)

Return to query results.
Submit another query.