DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Lcp65Af

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:74 Identity:24/74 - (32%)
Similarity:43/74 - (58%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRY 92
            |.|||..:: :...|:.:.:|::||:..:..|.:.:.. |.::.|.|.|.|.::.|.||...:.|
  Fly    18 VQILKQESD-VGPVSFNYGYETSDGSSAQAAGQLKNVG-TDEEALNVKGTYSFVADDGQTYSIAY 80

  Fly    93 TADKNGFLP 101
            |||:||:.|
  Fly    81 TADENGYQP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 17/55 (31%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.