DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:101 Identity:24/101 - (23%)
Similarity:40/101 - (39%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLILTGCQLLWSCPAECTSINVPV---PILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDS 65
            :.|:|...||:     .||....|.   .|....|.....|.|.|.|::.:|.          .:
  Fly     9 VFLVLVLVQLI-----HCTRFTAPSLDRTIYYRNTPPDPFGHYSFEFQTTNGI----------TT 58

  Fly    66 KTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLP 101
            |.:.::....|:.::::..|..|...|.||.||:.|
  Fly    59 KGAGNENGAVGVVQFVSPEGIPVTFSYVADANGYQP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 12/55 (22%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 12/55 (22%)

Return to query results.
Submit another query.