DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr65Az

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:91 Identity:27/91 - (29%)
Similarity:48/91 - (52%) Gaps:3/91 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRY 92
            :||:|..::..:.|||::.:|:.:|...||:|.:.:......:.....|.:.|.:..|||:.:.|
  Fly   114 IPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTY 178

  Fly    93 TADKNGFLPHVRYISKGEAYKPIRIE 118
            .||:|||.|...::   ....||.||
  Fly   179 IADENGFQPQGDHL---PTPPPIPIE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 15/55 (27%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.