DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Acp65Aa

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:108 Identity:32/108 - (29%)
Similarity:57/108 - (52%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFALLLILTGCQLLWSCPAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDS 65
            |..|:|::....||.:. |.....| .|.:|:..:|....|.|.||::.:|||.|.|.|:| :::
  Fly     1 MMKLMLVVGSIALLLAL-ASARPQN-DVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVV-NNA 62

  Fly    66 KTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLPHVRYISK 108
            .|.::.:.:.|...::...||...:.:.||:|||.|...::.|
  Fly    63 GTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLPK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 17/55 (31%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.