DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:101 Identity:29/101 - (28%)
Similarity:52/101 - (51%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLWSCPAECT-----SINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDL 72
            :.::|...|:     :|.....:|:..::.|..| |.|:.|::||...:|.|.: .|..|..:.:
  Fly     7 IAFTCILACSLAAPPAIQQDAQVLRFDSDVLPEG-YKFAVETSDGKSHQEEGQL-KDVGTDHEAI 69

  Fly    73 EVSGIYRYINDWGQEVEVRYTADKNGFLPHVRYISK 108
            .|.|.|.|:.|.||...::|.||:|||.|...::.:
  Fly    70 VVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 20/55 (36%)
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 20/55 (36%)

Return to query results.
Submit another query.