DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and l(3)mbn

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:73 Identity:18/73 - (24%)
Similarity:28/73 - (38%) Gaps:14/73 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKN 97
            |.|..|....|:..:..     .||.|..:.|.:         |.|..|.:...:..:.|.|::.
  Fly   569 SATGDLYKFKYILDYNG-----HEETGGRNGDKQ---------GSYFAIGEDAVQRTIEYIANEF 619

  Fly    98 GFLPHVRY 105
            ||.|||.:
  Fly   620 GFQPHVSW 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 10/55 (18%)
l(3)mbnNP_729143.2 Chitin_bind_4 575..621 CDD:459790 10/59 (17%)

Return to query results.
Submit another query.